Recombinant Human DSCAML1 protein (ab163552)

Overview

  • Product name
    Recombinant Human DSCAML1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SEPGICRFTASPPKPQDADRGKNVAVPIPHRANKSDYCNLPLYAKSEAFF RKADGREPCPVVPPREASIRNLARTYHTQARHLTLDP
    • Amino acids
      1922 to 2008
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163552 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Down syndrome cell adhesion molecule 2
    • Down syndrome cell adhesion molecule like 1
    • Down syndrome cell adhesion molecule like protein 1
    • Down syndrome cell adhesion molecule-like protein 1
    • DSCAM2
    • DSCAML1
    • DSCL1_HUMAN
    see all
  • Function
    Cell adhesion molecule that plays a role in neuronal self-avoidance. Promotes repulsion between specific neuronal processes of either the same cell or the same subtype of cells. Promotes both isoneuronal self-avoidance for creating an orderly neurite arborization in retinal rod bipolar cells and heteroneuronal self-avoidance to maintain mosaic spacing between AII amacrine cells.
  • Tissue specificity
    Detected in heart, liver, pancreas, skeletal muscle, kidney and in brain, in particular in the amygdala, caudate nucleus, corpus callosum, hippocampus, substantia nigra, thalamus and subthalamus.
  • Sequence similarities
    Contains 6 fibronectin type-III domains.
    Contains 10 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab163552 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163552 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163552.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up