Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSEKKQPVDLGLLEEDDEFEEFPAEDW AGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS
    • Molecular weight
      11 kDa including tags
    • Amino acids
      1 to 70
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NCBI Accession No. NP_006295).

Specifications

Our Abpromise guarantee covers the use of ab174412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab174412 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • 26S proteasome complex subunit DSS1
    • C7orf76
    • Deleted in split hand/split foot 1
    • Deleted in split hand/split foot protein 1
    • Deleted in Split-Hand/Split-Foot 1 region
    • ECD
    • SEM1
    • SEM1 26S proteasome complex subuni
    • SHFD1
    • Shfdg1
    • SHFM1
    • SHSF1
    • Split hand/foot deleted protein 1
    • Split hand/foot malformation (ectrodactyly) type 1
    • Split hand/foot malformation type 1 protein
    see all
  • Relevance
    The gene for DSS1 has been localized within the split hand/split foot malformation locus SHFM1 at chromosome 7. DSS1 has been proposed to be a candidate for the autosomal dominant form of the heterogeneous limb developmental disorder split hand/split foot malformation type 1. In addition, it has been shown to directly interact with BRCA2. It also may play a role in the completion of the cell cycle.

Images

  • 15% SDS-PAGE analysis of ab174412 (3 µg).

References

ab174412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up