Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEK NLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQV RREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLA EETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLA DGQKELHYLPFPSP
    • Amino acids
      1 to 214
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dilute suppressor
    • Dilute suppressor protein homolog
    • DSU
    • FLJ10116
    • Melanoregulin
    • MGC90296
    • MREG
    • OTTHUMP00000206794
    • OTTHUMP00000206795
    • OTTHUMP00000206796
    • WDT 2
    • WDT2
    • Whn dependent transcript 2
    see all
  • Relevance
    DSU (Dilute suppressor) is also known as Melanoregulin. It has a role in the incorporation of pigments into hair. It is involved in organelle biogenesis and may function in membrane fusion. It may also regulate the biogenesis of disk membranes, specialized organelles of photoreceptor rod cells.
  • Cellular localization
    Apical cell membrane; Peripheral membrane protein. Note: Localizes to the inner segment and basal outer segment of rods in the retina.

Images

  • ab163177 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up