Overview

  • Product name
    Recombinant Human DTX3L protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPG TFRVEFSERAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQIS SLTQSQAE
    • Amino acids
      3 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B lymphoma and BAL associated protein
    • B-lymphoma- and BAL-associated protein
    • BBAP
    • Deltex 3 like
    • DTX 3L
    • DTX3L
    • DTX3L_HUMAN
    • E3 ubiquitin-protein ligase DTX3L
    • Protein deltex 3 like
    • Protein deltex 3 like protein
    • Protein deltex-3-like
    • Rhysin 2
    • Rhysin-2
    • Rhysin2
    see all
  • Function
    Ubiquitin ligase that mediates monoubiquitination of 'Lys-91' of histone H4 (H4K91ub1), in response to DNA damage. Protects cells exposed to DNA-damaging agents. The exact role of H4K91ub1 in DNA damage response is still unclear but it may function as a licensing signal for additional histone H4 post-translational modifications such as H4 'Lys-20' methylation (H4K20me). Involved in the recruitment of 53BP1/TP53BP1 to sites of DNA damage by mediating H4K91ub1 formation.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the Deltex family.
    Contains 1 RING-type zinc finger.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab165631 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up