Overview

  • Product nameRecombinant Human Dub3 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ6R6M4
    • SpeciesHuman
    • SequenceESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHP EQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ
    • Molecular weight37 kDa including tags
    • Amino acids431 to 530

Specifications

Our Abpromise guarantee covers the use of ab112436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cytokine inducible Deubiquitinating Enzyme
    • Deubiquitinating enzyme 17-like protein 2
    • Deubiquitinating enzyme 3
    • Deubiquitinating protein 3
    • DUB-3
    • DUB3 protein
    • U17L2_HUMAN
    • Ubiquitin carboxyl-terminal hydrolase 17-like protein 2
    • Ubiquitin thiolesterase 17-like protein 2
    • Ubiquitin-specific-processing protease 17-like protein 2
    • USP17L2
    see all
  • FunctionDeubiquitinating enzyme that specifically removes conjugated ubiquitin from CDC25A, thereby playing a key role in cell cycle regulation. Deubiquitination of CDC25A prevents its degradation by the proteasome during the G1/S and G2/M phases of the cell cycle and is required for cell-cycle progression. Has transforming capabilities on cell lines. May also function in cell apoptosis.
  • Tissue specificityBroadly expressed.
  • Sequence similaritiesBelongs to the peptidase C19 family. USP17 subfamily.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Dub3 protein images

  • 12.5% SDS-PAGE showing ab112436 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human Dub3 protein (ab112436)

ab112436 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"