Overview

  • Product name
    Recombinant Human DUOX1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPM DTDPPQEIRRRFGKKVTSFQPLLFTEAHREKFQRSCLH
    • Amino acids
      941 to 1028
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162709 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dual oxidase 1
    • Dual oxidase 1 precursor
    • DUOX1
    • EC 1.11.1
    • EC 1.6.3.1
    • Flavoprotein NADPH oxidase
    • Large NOX 1
    • LNOX1
    • Long NOX 1
    • MGC138840
    • MGC138841
    • NADPH thyroid oxidase 1
    • Nicotinamide adenine dinucleotide phosphate oxidase
    • NOXEF1
    • THOX1
    • Thyroid oxidase 1
    see all
  • Relevance
    The protein encoded by this gene is a glycoprotein and a member of the NADPH oxidase family. The synthesis of thyroid hormone is catalyzed by a protein complex located at the apical membrane of thyroid follicular cells. This complex contains an iodide transporter, thyroperoxidase, and a peroxide generating system that includes this encoded protein and DUOX2. This protein is known as dual oxidase because it has both a peroxidase homology domain and a gp91phox domain. Two alternatively spliced transcript variants encoding the same protein have been described for this gene (from EntrezGene).
  • Cellular localization
    Cell Membrane

Images

  • ab162709 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162709 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162709.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up