Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSAL SYLQSPITTSPSC
    • Molecular weight
      33 kDa including tags
    • Amino acids
      305 to 367
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CL 100
    • CL100
    • Dual Specificity Phosphatase 1
    • Dual specificity protein phosphatase 1
    • Dual specificity protein phosphatase hVH1
    • DUS1_HUMAN
    • DUSP 1
    • Dusp1
    • HVH1
    • MAP kinase phosphatase 1
    • Mitogen-activated protein kinase phosphatase 1
    • MKP-1
    • MKP1
    • Protein tyrosine phosphatase CL100
    • Protein-tyrosine phosphatase CL100
    • PTPN10
    • Serine/threonine specific protein phosphatase
    • VH1
    see all
  • Function
    Dual specificity phosphatase that dephosphorylates MAP kinase ERK2 on both 'Thr-183' and 'Tyr-185'.
  • Tissue specificity
    Expressed at high levels in the lung, liver placenta and pancreas. Moderate levels seen in the heart and skeletal muscle. Lower levels found in the brain and kidney.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 rhodanese domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152347 stained with Coomassie Blue.

References

ab152347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up