Recombinant Human DUSP10 protein (ab123213)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMIIYPNDLAKKMTKCSKSHLPSQGPV IIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKD SFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGL SSFKQNHENLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELT PILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRL PATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYL MKHTRMTMTD AYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV
    • Molecular weight
      40 kDa including tags
    • Amino acids
      149 to 482
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab123213 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • Dual specificity phosphatase 10
    • Dual specificity phosphatase MKP 5
    • Dual specificity phosphatase MKP5
    • Dual specificity protein phosphatase 10
    • DUS10_HUMAN
    • DUSP 10
    • DUSP10
    • DUSP10 protein
    • MAP kinase phosphatase 5
    • Mitogen activated protein kinase phosphatase 5
    • Mitogen-activated protein kinase phosphatase 5
    • MKP 5
    • MKP-5
    • MKP5
    • Serine/threonine specific protein phosphatase
    see all
  • Function
    Involved in the inactivation of MAP kinases. Has a specificity for the MAPK11/MAPK12/MAPK13/MAPK14 subfamily.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 rhodanese domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab123213 (3 µg) at approximately 40.4 kDa.

References

ab123213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up