Recombinant Human DUSP10 protein (ab123213)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMIIYPNDLAKKMTKCSKSHLPSQGPV IIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKD SFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGL SSFKQNHENLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELT PILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRL PATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYL MKHTRMTMTD AYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV
    • Molecular weight
      40 kDa including tags
    • Amino acids
      149 to 482
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab123213 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • Dual specificity phosphatase 10
    • Dual specificity phosphatase MKP 5
    • Dual specificity phosphatase MKP5
    • Dual specificity protein phosphatase 10
    • DUS10_HUMAN
    • DUSP 10
    • DUSP10
    • DUSP10 protein
    • MAP kinase phosphatase 5
    • Mitogen activated protein kinase phosphatase 5
    • Mitogen-activated protein kinase phosphatase 5
    • MKP 5
    • MKP-5
    • MKP5
    • Serine/threonine specific protein phosphatase
    see all
  • Function
    Involved in the inactivation of MAP kinases. Has a specificity for the MAPK11/MAPK12/MAPK13/MAPK14 subfamily.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 rhodanese domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human DUSP10 protein images

  • 15% SDS-PAGE showing ab123213 (3 µg) at approximately 40.4 kDa.

References for Recombinant Human DUSP10 protein (ab123213)

ab123213 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up