Recombinant Human DUSP22 protein (ab163442)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKY LCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVI AYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWL KEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
    • Amino acids
      1 to 184
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dual specificity protein phosphatase 22
    • DUS22_HUMAN
    • Dusp22
    • JNK stimulatory phosphatase 1
    • JNK-stimulatory phosphatase-1
    • JSP 1
    • JSP-1
    • JSP1
    • LMW DSP2
    • LMW-DSP2
    • Low molecular weight dual specificity phosphatase 2
    • MAP kinase phosphatase x
    • Mitogen activated protein kinase phosphatase x
    • Mitogen-activated protein kinase phosphatase x
    • MKP-x
    • MKPX
    see all
  • Function
    Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK).
  • Tissue specificity
    Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab163442 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up