Recombinant Human DUSP23 protein (ab117235)

Overview

  • Product nameRecombinant Human DUSP23 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BVJ7
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGVQPPNFSWVLPGRLAGLALPRLPAHYQF LLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQI VDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRP GSIETYEQEKAVFQFYQRTK
    • Molecular weight19 kDa including tags
    • Amino acids1 to 150
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117235 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab117235 is purified using conventional chromatography techniques.
  • FormLiquid
  • Additional notesEC=3.1.3.48.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Dual specificity phosphatase 23
    • Dual specificity protein phosphatase 23
    • DUS23_HUMAN
    • Dusp23
    • DUSP25
    • EC 3.1.3.16
    • EC 3.1.3.48
    • FLJ20442
    • LDP 3
    • LDP-3
    • LDP3
    • Low molecular mass dual specificity phosphatase 3
    • MOSP
    • RP11-190A12.1
    • VH1 like member Z
    • VH1 like phosphatase Z
    • VH1-like phosphatase Z
    • VHZ
    see all
  • FunctionProtein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).
  • Tissue specificityWidely expressed. Highly expressed in spleen, prostate, colon, adrenal gland, mammary gland, thyroid and trachea. Expressed at lower level in uterus, small intestine, bladder, bone marrow, brain, spinal cord and stomach.
  • Sequence similaritiesBelongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localizationCytoplasm > cytosol. Nucleus. Mainly cytosolic. Also nuclear.
  • Information by UniProt

Recombinant Human DUSP23 protein images

  • 15% SDS-PAGE showing ab117235 at approximately 18.8kDa (3µg).

References for Recombinant Human DUSP23 protein (ab117235)

ab117235 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. The activity for ab 113160 is as follows:

Specific activity: >1,750 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme hydrolyzing 1 nmole of p-nitrophenyl phosphate (pNPP) per minute ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"