Recombinant Human DUSP3 protein (ab113160)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP51452
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSGSFELSVQDLNDLLSDGSGCYSLPSQPC NEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHNTNANFYKDS GITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRS PTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEG KLKP
    • Molecular weight23 kDa including tags
    • Amino acids1 to 205
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113160 was purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.04% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • Dual specificity phosphatase 3
    • Dual specificity protein phosphatase 3
    • Dual specificity protein phosphatase VHR
    • DUS3_HUMAN
    • DUSP3
    • Serine/threonine specific protein phosphatase
    • Vaccinia H1-related phosphatase
    • Vaccinia virus phosphatase VH1 related
    • VHR
    see all
  • FunctionShows activity both for tyrosine-protein phosphate and serine-protein phosphate, but displays a strong preference toward phosphotyrosines. Specifically dephosphorylates and inactivates ERK1 and ERK2.
  • Sequence similaritiesBelongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DUSP3 protein images

  • ab113160 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human DUSP3 protein (ab113160)

ab113160 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. The activity for ab 113160 is as follows:

Specific activity: >1,750 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme hydrolyzing 1 nmole of p-nitrophenyl phosphate (pNPP) per minute ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"