Overview

  • Product nameRecombinant Human DUSP5 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16690
    • SpeciesHuman
    • SequenceLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAG SSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
    • Molecular weight37 kDa including tags
    • Amino acids286 to 384

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114458 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Dual specificity phosphatase 5
    • Dual specificity protein phosphatase 5
    • Dual specificity protein phosphatase hVH 3
    • Dual specificity protein phosphatase hVH3
    • DUS5_HUMAN
    • DUSP
    • DUSP 5
    • DUSP5
    • HVH 3
    • HVH3
    • Serine/threonine specific protein phosphatase
    • VH 3
    • VH1 like phosphatase 3
    • VH3
    see all
  • FunctionDisplays phosphatase activity toward several substrates. The highest relative activity is toward ERK1.
  • Sequence similaritiesBelongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 rhodanese domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DUSP5 protein images

  • ab114458 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human DUSP5 protein (ab114458)

ab114458 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114458.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"