Recombinant Human DYNC1LI2 protein (ab158301)

Overview

  • Product name
    Recombinant Human DYNC1LI2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSK LPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDD HTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMSRPWTVMESLQ KWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGP LTSGSDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEH LDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPA LVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH DKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGP ASVPSSSPGTSVKKPDPNIKNNAASEGVLASFFNSLLSKKTGSPGSPGAG GVQSTAKNSGQKTVLSNVQEELDRMTRKPDSMVTNSSTENEA
    • Amino acids
      1 to 492
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cytoplasmic dynein 1 light intermediate chain 2
    • cytosolic
    • DC1L2_HUMAN
    • DNCLI2
    • Dync1li2
    • Dynein cytoplasmic 1 light intermediate chain 2
    • Dynein light intermediate chain 2
    • dynein light intermediate chain 2 cytosolic
    • dynein, cytoplasmic, light intermediate polypeptide 2
    • LIC-2
    • LIC2
    • LIC53/55
    • OTTHUMP00000174820
    see all
  • Function
    Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in binding dynein to membranous organelles or chromosomes.
  • Sequence similarities
    Belongs to the dynein light intermediate chain family.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab158301 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158301 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up