Recombinant Human Dynein light chain protein (ab107140)

Overview

  • Product nameRecombinant Human Dynein light chain protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO96015
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGETEGKKDEADYKRLQTFPLVRHSDMPEE MRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFE ITHEVKNLLYLYFGGTLAVCVWKCS
    • Molecular weight14 kDa including tags
    • Amino acids1 to 105
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab107140 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • D15Ertd424e
    • Dnal4
    • DNAL4_HUMAN
    • Dnalc4
    • Dynein axonemal light chain 4
    • Dynein light chain 4, axonemal
    • Dynein light chain, outer arm 4
    • Dynein, axonemal, light 4
    • Dynein, axonemal, light polypeptide 4
    • MGC105573
    • PIG27
    • Proliferation inducing gene 27
    • Proliferation inducing protein 27
    see all
  • FunctionForce generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity.
  • Sequence similaritiesBelongs to the dynein light chain family.
  • Cellular localizationCytoplasm > cytoskeleton > cilium axoneme.
  • Information by UniProt

Recombinant Human Dynein light chain protein images

  • 15% SDS-PAGE showing ab107140 (3 µg) at approximately 14.1 kDa.

References for Recombinant Human Dynein light chain protein (ab107140)

ab107140 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"