Recombinant Human Dynein light chain protein (ab107140)

Overview

  • Product name
    Recombinant Human Dynein light chain protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGETEGKKDEADYKRLQTFPLVRHSDMPEE MRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFE ITHEVKNLLYLYFGGTLAVCVWKCS
    • Molecular weight
      14 kDa including tags
    • Amino acids
      1 to 105
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab107140 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • D15Ertd424e
    • Dnal4
    • DNAL4_HUMAN
    • Dnalc4
    • Dynein axonemal light chain 4
    • Dynein light chain 4, axonemal
    • Dynein light chain, outer arm 4
    • Dynein, axonemal, light 4
    • Dynein, axonemal, light polypeptide 4
    • MGC105573
    • PIG27
    • Proliferation inducing gene 27
    • Proliferation inducing protein 27
    see all
  • Function
    Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity.
  • Sequence similarities
    Belongs to the dynein light chain family.
  • Cellular localization
    Cytoplasm > cytoskeleton > cilium axoneme.
  • Information by UniProt

Recombinant Human Dynein light chain protein images

  • 15% SDS-PAGE showing ab107140 (3 µg) at approximately 14.1 kDa.

References for Recombinant Human Dynein light chain protein (ab107140)

ab107140 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up