Recombinant Human Dynein light chain protein (ab107140)

Overview

  • Product name
    Recombinant Human Dynein light chain protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGETEGKKDEADYKRLQTFPLVRHSDMPEE MRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFE ITHEVKNLLYLYFGGTLAVCVWKCS
    • Molecular weight
      14 kDa including tags
    • Amino acids
      1 to 105
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab107140 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • D15Ertd424e
    • Dnal4
    • DNAL4_HUMAN
    • Dnalc4
    • Dynein axonemal light chain 4
    • Dynein light chain 4, axonemal
    • Dynein light chain, outer arm 4
    • Dynein, axonemal, light 4
    • Dynein, axonemal, light polypeptide 4
    • MGC105573
    • PIG27
    • Proliferation inducing gene 27
    • Proliferation inducing protein 27
    see all
  • Function
    Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity.
  • Sequence similarities
    Belongs to the dynein light chain family.
  • Cellular localization
    Cytoplasm > cytoskeleton > cilium axoneme.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107140 (3 µg) at approximately 14.1 kDa.

References

ab107140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up