Recombinant Human Dynein protein (ab108119)

Overview

  • Product name
    Recombinant Human Dynein protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSDRKAVIKNADMSEDMQQDAVDCATQAME KYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ VAILLFKSG
    • Molecular weight
      13 kDa including tags
    • Amino acids
      1 to 89
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab108119 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 8 kDa dynein light chain b
    • C87222
    • cytoplasmic
    • Dlc2
    • DLC8b
    • DNCL1B
    • DYL2_HUMAN
    • Dynein light chain 2
    • Dynein light chain 2, cytoplasmic
    • Dynein light chain LC8 type 2
    • Dynein light chain LC8-type 2
    • Dynll2
    • MGC17810
    • MGC72334
    see all
  • Function
    Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
  • Sequence similarities
    Belongs to the dynein light chain family.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human Dynein protein images

  • 15% SDS-PAGE showing ab108119 at approximately 12.5kDa (3µg).

References for Recombinant Human Dynein protein (ab108119)

ab108119 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up