Recombinant Human DYNLL1 protein (ab101204)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP63167
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMCDRKAVIKNADMSEEMQQDSVECATQALE KYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ VAILLFKSG
    • Molecular weight13 kDa including tags
    • Amino acids1 to 89
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    purified by using conventional chromatography techniques
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 8 kDa dynein light chain
    • 8kDLC
    • Cytoplasmic dynein light polypeptide
    • DLC1
    • DLC8
    • DNCL1
    • DNCLC1
    • DYL1_HUMAN
    • Dynein , cytoplasmic, light chain 1
    • Dynein light chain 1 cytoplasmic
    • Dynein light chain 1, cytoplasmic
    • Dynein light chain LC8 type 1
    • Dynein light chain LC8-type 1
    • Dynein, cytoplasmic, light polypeptide 1
    • Dynein, light chain, LC8-type 1
    • DYNLL1
    • HDLC1
    • LC8
    • LC8a
    • MGC126137
    • MGC126138
    • MGC72986
    • PIN
    • Protein inhibitor of neuronal nitric oxide synthase
    • Protein inhibitor of neuronal NOS
    see all
  • FunctionActs as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
    Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.
    Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.
    Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the dynein light chain family.
  • Post-translational
    modifications
    Phosphorylation at Ser-88 appears to control the dimer-monomer transition. According to PubMed:15193260, it is phosphorylated at Ser-88 by PAK1, however, according to PubMed:18650427, the DYNLL1 dimer is not accessible for PAK1 and the phosphorylation could not be demonstrated in vitro.
  • Cellular localizationCytoplasm, cytoskeleton. Nucleus. Mitochondrion. Upon induction of apoptosis translocates together with BCL2L11 to mitochondria.
  • Information by UniProt

Recombinant Human DYNLL1 protein images

  • ab101204 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human DYNLL1 protein (ab101204)

ab101204 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"