Recombinant Human DYNLRB2 protein (ab104646)

Overview

  • Product nameRecombinant Human DYNLRB2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8TF09
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAEVEETLKRIQSHKGVIGTMVVNAEGIPI RTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMV APDKEYLLIVIQNPCE
    • Molecular weight13 kDa including tags
    • Amino acids1 to 96
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104646 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • cytoplasmic
    • DLRB2_HUMAN
    • DNCL2B
    • DNLC2B
    • Dynein light chain 2B
    • Dynein light chain 2B, cytoplasmic
    • Dynein light chain roadblock-type 2
    • DYNLRB2
    • Roadblock domain-containing protein 2
    • ROBLD2
    see all
  • FunctionActs as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
  • Tissue specificityHigh expression in heart, brain, placenta, skeletal muscle, prostate and small intestine; moderate in kidney, pancreas, spleen, testis, ovary and colon; low in lung, liver, thymus and leukocyte.
  • Sequence similaritiesBelongs to the GAMAD family.
  • Cellular localizationCytoplasm, cytoskeleton.
  • Information by UniProt

Recombinant Human DYNLRB2 protein images

  • 15% SDS-PAGE showing ab104646 at approximately 13kDa (3µg).

References for Recombinant Human DYNLRB2 protein (ab104646)

ab104646 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"