Recombinant Human DYNLRB2 protein (ab104646)

Overview

  • Product name
    Recombinant Human DYNLRB2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAEVEETLKRIQSHKGVIGTMVVNAEGIPI RTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMV APDKEYLLIVIQNPCE
    • Molecular weight
      13 kDa including tags
    • Amino acids
      1 to 96
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab104646 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • cytoplasmic
    • DLRB2_HUMAN
    • DNCL2B
    • DNLC2B
    • Dynein light chain 2B
    • Dynein light chain 2B, cytoplasmic
    • Dynein light chain roadblock-type 2
    • DYNLRB2
    • Roadblock domain-containing protein 2
    • ROBLD2
    see all
  • Function
    Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
  • Tissue specificity
    High expression in heart, brain, placenta, skeletal muscle, prostate and small intestine; moderate in kidney, pancreas, spleen, testis, ovary and colon; low in lung, liver, thymus and leukocyte.
  • Sequence similarities
    Belongs to the GAMAD family.
  • Cellular localization
    Cytoplasm, cytoskeleton.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab104646 at approximately 13kDa (3µg).

References

ab104646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up