Recombinant Human DYRK1A protein (ab114522)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFS ANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVAS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      674 to 763

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Dual specificity tyrosine phosphorylation regulated kinase
    • Dual specificity tyrosine (Y) phosphorylation regulated kinase 1A
    • Dual specificity tyrosine phosphorylation regulated kinase 1
    • Dual specificity tyrosine phosphorylation regulated kinase 1A
    • Dual specificity tyrosine-phosphorylation-regulated kinase 1A
    • Dual specificity YAK 1 related kinase
    • Dual specificity YAK1 related kinase
    • Dual specificity YAK1-related kinase
    • DYR1A_HUMAN
    • DYRK
    • DYRK 1
    • DYRK 1A
    • DYRK1
    • Dyrk1a
    • DYRKA
    • hMNB
    • HP 86
    • HP86
    • Minibrain (Drosophila) homolog
    • Minibrain homolog
    • Minibrain, Drosophila, homolog of
    • MNB
    • MNB protein kinase
    • Mnb protein kinase homolog hp86
    • MNB protein kinase, Serine/threonine-specific
    • MNB/DYRK protein kinase
    • MNBH
    • MRD7
    • OTTHUMP00000109090
    • OTTHUMP00000109091
    • OTTHUMP00000109094
    • OTTHUMP00000174799
    • Protein kinase minibrain homolog
    • Serine/threonine kinase MNB
    see all
  • Function
    May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.
  • Tissue specificity
    Ubiquitous. Highest levels in skeletal muscle, testis, fetal lung and fetal kidney.
  • Involvement in disease
    Defects in DYRK1A are the cause of mental retardation autosomal dominant type 7 (MRD7) [MIM:614104]. A disease characterized by primary microcephaly, severe mental retardation without speech, anxious autistic behavior, and dysmorphic features, including bitemporal narrowing, deep-set eyes, large simple ears, and a pointed nasal tip. Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
    Contains 1 protein kinase domain.
  • Developmental stage
    Expressed in the developing central nervous system. Overexpressed 1.5-fold in fetal Down syndrome brain.
  • Domain
    The polyhistidine repeats act as targeting signals to nuclear speckles (PubMed:19266028).
  • Post-translational
    modifications
    Autophosphorylated on tyrosine residues.
  • Cellular localization
    Nucleus speckle.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of Human DYRK1A protein (ab114522). Stained with Coomassie Blue.

References

ab114522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.

I can confirm the protein ab114522 is exactly the immunising peptide for ab54944 and could therefore serve as a positive control.

I hope this information was helpful. Please do not hesitate to contact us...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up