Recombinant Human DYRK1A protein (ab114522)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13627
    • SpeciesHuman
    • SequenceNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFS ANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVAS
    • Molecular weight36 kDa including tags
    • Amino acids674 to 763

Specifications

Our Abpromise guarantee covers the use of ab114522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Dual specificity tyrosine phosphorylation regulated kinase
    • Dual specificity tyrosine (Y) phosphorylation regulated kinase 1A
    • Dual specificity tyrosine phosphorylation regulated kinase 1
    • Dual specificity tyrosine phosphorylation regulated kinase 1A
    • Dual specificity tyrosine-phosphorylation-regulated kinase 1A
    • Dual specificity YAK 1 related kinase
    • Dual specificity YAK1 related kinase
    • Dual specificity YAK1-related kinase
    • DYR1A_HUMAN
    • DYRK
    • DYRK 1
    • DYRK 1A
    • DYRK1
    • Dyrk1a
    • DYRKA
    • hMNB
    • HP 86
    • HP86
    • Minibrain (Drosophila) homolog
    • Minibrain homolog
    • Minibrain, Drosophila, homolog of
    • MNB
    • MNB protein kinase
    • Mnb protein kinase homolog hp86
    • MNB protein kinase, Serine/threonine-specific
    • MNB/DYRK protein kinase
    • MNBH
    • MRD7
    • OTTHUMP00000109090
    • OTTHUMP00000109091
    • OTTHUMP00000109094
    • OTTHUMP00000174799
    • Protein kinase minibrain homolog
    • Serine/threonine kinase MNB
    see all
  • FunctionMay play a role in a signaling pathway regulating nuclear functions of cell proliferation. Phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.
  • Tissue specificityUbiquitous. Highest levels in skeletal muscle, testis, fetal lung and fetal kidney.
  • Involvement in diseaseDefects in DYRK1A are the cause of mental retardation autosomal dominant type 7 (MRD7) [MIM:614104]. A disease characterized by primary microcephaly, severe mental retardation without speech, anxious autistic behavior, and dysmorphic features, including bitemporal narrowing, deep-set eyes, large simple ears, and a pointed nasal tip. Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
    Contains 1 protein kinase domain.
  • Developmental stageExpressed in the developing central nervous system. Overexpressed 1.5-fold in fetal Down syndrome brain.
  • DomainThe polyhistidine repeats act as targeting signals to nuclear speckles (PubMed:19266028).
  • Post-translational
    modifications
    Autophosphorylated on tyrosine residues.
  • Cellular localizationNucleus speckle.
  • Information by UniProt

Recombinant Human DYRK1A protein images

  • 12.5% SDS-PAGE analysis of Human DYRK1A protein (ab114522). Stained with Coomassie Blue.

References for Recombinant Human DYRK1A protein (ab114522)

ab114522 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

I can confirm the protein ab114522 is exactly the immunising peptide for ab54944 and could therefore serve as a positive control.

I hope this information was helpful. Please do not hesitate to contact us...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"