Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVP ERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHH EIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYE VLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHL RKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLP LVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSC YEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLP GEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDG SVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVR MTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSA SKLRTNLAQMTDANGNIQQRTVLPKLVS
    • Molecular weight
      84 kDa including tags
    • Amino acids
      1 to 528

Specifications

Our Abpromise guarantee covers the use of ab152869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

    Functional Studies

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 1810038L18Rik
    • Dual specificity tyrosine (Y) phosphorylation regulated kinase 2
    • Dual specificity tyrosine phosphorylation regulated kinase 2
    • Dual specificity tyrosine-phosphorylation-regulated kinase 2
    • DYRK2
    • DYRK2_HUMAN
    • EC 2.7.12.1
    • FLJ21217
    • FLJ21365
    see all
  • Function
    Role in the regulation of cellular growth and/or development. Regulates TP53 by phosphorylation on Ser-46 to induce apoptosis in response to DNA damage, functioning downstream of ATM. Inactivates GYS1 by phosphorylation at Ser-641, and potentially also a second phosphorylation site, thus regulating glycogen synthesis. Phosphorylates EIF2B5 at Ser-544, enabling its subsequent phosphorylation and inhibition by GSK3, and may play a more general role in the priming of GSK3 substrates.
  • Tissue specificity
    Testis, after the onset of spermatogenesis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated on serine/threonine residues.
  • Cellular localization
    Cytoplasm. Nucleus. Translocates into the nucleus following DNA damage.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152869 stained with Coomassie Blue.
  • Kinase Assay using ab152869 and [gamma 32P] ATP radioisotope.

    Fig.1 SDS-PAGE gel
    Fig.2 Autoradiograph of SDS-PAGE gel

    Kinase substrates:
    H3 histone, family 3A - calf thymus, Molecular weight: approx. 16.5-17 kDa on SDS-PAGE
    Myelin basic protein - bovine brain, Molecular weight: approx. 21-22 kDa on SDS-PAGE
    Histone H1.0 - calf thymus, Molecular weight: approx. 32-33 kDa on SDS-PAGE
    Beta-casein protein - bovine milk, Molecular weight: approx. 33-34 kDa on SDS-PAGE

References

ab152869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up