Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKG RLLSHIEKLRTSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIK DFTCNPLNSI
    • Amino acids
      341 to 450
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DAZ interacting protein 1/2
    • DAZ interacting protein testis1
    • DZIP
    • DZIP2
    • DZIPt1
    • Zinc finger DAZ interacting protein 1
    • Zinc finger protein DZIP1
    • Zinc finger protein DZIPt1
    see all
  • Relevance
    DZIP1 may participate in spermatogenesis via its interaction with DAZ. Isoform 1 and isoform 2 interact with DAZ proteins. DZIP1 may also participate in a RNA-binding complex that functions in both ES cells and germ cells. There are three named isoforms.
  • Cellular localization
    Nucleus. Cytoplasm. Note: In testis, it is predominantly nuclear, with some cytoplasmic localization in spermatogonia. Co-localizes with DAZ and DAZL in primordial germ cells.

Images

  • ab161453 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up