Recombinant Human E2 230K protein (BSA and azide free) (ab172183)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTVEQLLTGSPTSPTVEPEKPTREKKFLDDIKKLQENLKKTLDNVAIVEE EKMEAVPDVERKEDKPEGQSPVKAEWPSET PVLCQQCGGKPGVTFTSA KGEVFSVLEFAPSNHSFKKIEFQPPEAKKFFSTVRKEMALLATSLPEGIM VKTFEDRMDLFS ALIKGPTRTPYEDGLYLFDIQLPNIYPAVPPHFCYL SQCSGRLNPNLYDNGKVCVSLLGTCIGKGTERWTSKSSLLQVLI SIQG LILVNEPYYNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPP EVFEQEIRQHFSTGGWRLVNRIESWL ETHALLEKAQALPNGVPKASSS PEPPAVAELSDSGQQEPEDGGPAPGEASQGSDSEGGAQSLASASRDHTDQ TSETAPDA SVPPSVKPKKRRKSYRSFLPEKSGYPDIGFPLFPLSKGFI KSIRGVLTQFRAALLEAGMPECTEDK
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 466
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity
    > 95 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris-HCl buffer, 25% Glycerol, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF

General Info

  • Alternative names
    • E2 230K
    • EC=6.3.2.19
    • FLJ12878
    • KIAA1734
    • Likely Ortholog of Mouse Ubiquitin Conjugating Enzyme
    • RP23 193A16.5
    • UBE2O
    • UBE2O_HUMAN
    • Ubiquitin carrier protein O
    • Ubiquitin conjugating enzyme E2 O
    • Ubiquitin conjugating enzyme E2 of 230 kDa
    • ubiquitin conjugating enzyme E2O
    • Ubiquitin protein ligase O
    • Ubiquitin-conjugating enzyme E2 O
    • Ubiquitin-conjugating enzyme E2 of 230 kDa
    • Ubiquitin-conjugating enzyme E2-230K
    • Ubiquitin-protein ligase O
    see all
  • Function
    Catalyzes the covalent attachment of ubiquitin to other proteins.
  • Tissue specificity
    Predominantly expressed in skeletal muscle and heart.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

Images

  • ab172183 on SDS-PAGE, MW ~90 kDa.

References

ab172183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up