Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPE EFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
    • Molecular weight
      36 kDa including tags
    • Amino acids
      348 to 437

Specifications

Our Abpromise guarantee covers the use of ab152349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dmel\CG6376
    • Dmel_CG6376
    • drosE2F1
    • E(Sev-CycE)3A
    • E(var)3-93E
    • E2-promoter binding facto
    • E2F 1
    • E2F transcription factor 1
    • E2F-1
    • E2f-PA
    • E2f-PB
    • E2f-PC
    • E2F1
    • E2f1 E2F transcription factor 1
    • E2F1_HUMAN
    • Evar(3)164
    • KIAA4009
    • l(3)07172
    • l(3)j3B1
    • l(3)j3C2
    • l(3)rM729
    • mKIAA4009
    • OTTHUMP00000030661
    • PBR3
    • PRB binding protein E2F 1
    • PRB-binding protein E2F-1
    • RBAP 1
    • RBAP-1
    • RBAP1
    • RBBP-3
    • RBBP3
    • RBP 3
    • RBP3
    • Retinoblastoma-associated protein 1
    • Retinoblastoma-binding protein 3
    • Transcription factor E2F1
    see all
  • Function
    Transcription activator that binds DNA cooperatively with dp proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F-1 binds preferentially RB1 protein, in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent apoptosis.
  • Sequence similarities
    Belongs to the E2F/DP family.
  • Post-translational
    modifications
    Phosphorylated by CDK2 and cyclin A-CDK2 in the S-phase.
    Acetylation stimulates DNA-binding. Enhanced under stress conditions such as DNA damage and inhibited by retinoblastoma protein pRB. Regulated by KAP1/TRIM28 which recruits HDAC1 to E2F1 resulting in deacetylation. Acetylated by P/CAF/KAT2B.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152349 stained with Coomassie Blue.

References

ab152349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up