Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDYRHAPPRPANF VFLVETGFCHVSQAGLELLTSSDPPPRPPKVLR
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 83

Specifications

Our Abpromise guarantee covers the use of ab114610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dE2F2
    • E2F transcription factor 2
    • E2F-2
    • E2F2
    • E2F2_HUMAN
    • Transcription factor E2F2
    see all
  • Function
    Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F-2 binds specifically to RB1 protein, in a cell-cycle dependent manner.
  • Tissue specificity
    Highest level of expression is found in placenta, low levels are found in lung. Found as well in many immortalized cell lines derived from tumor samples.
  • Sequence similarities
    Belongs to the E2F/DP family.
  • Post-translational
    modifications
    Phosphorylated by CDK2 and cyclin A-CDK2 in the S-phase.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114610 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up