Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLP SHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAF PHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV
    • Molecular weight
      41 kDa including tags
    • Amino acids
      1 to 133

Specifications

Our Abpromise guarantee covers the use of ab114534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686C18211
    • E2F 3
    • E2F transcription factor 3
    • E2F-3
    • E2F3
    • E2F3_HUMAN
    • KIAA0075
    • MGC104598
    • Transcription factor E2F 3
    • Transcription factor E2F3
    see all
  • Function
    Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F-3 binds specifically to RB1 protein, in a cell-cycle dependent manner.
  • Sequence similarities
    Belongs to the E2F/DP family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human E2F3 protein images

  • 12.5% SDS-PAGE showing ab114534 at approximately 40.74kDa stained with Coomassie Blue.

References for Recombinant Human E2F3 protein (ab114534)

ab114534 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114534.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up