Overview

  • Product name
    Recombinant Human E2F4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTL AVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIEL KAEIEELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHEDICRCFA GDTLLAIRAPSGTSLEVPIPEGLNGQKKYQIHLKSVSGPIEVLLVNKEAW SSPPVAVPVPPPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPT AVPGSAEVQGMAGPAAEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ SSALLDSSSSSSSSSSSSSNSNSSSSSGPNPSTSFEPIKADPTGVLELPK ELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESE GVCDLFDVPVLNL
    • Molecular weight
      70 kDa including tags
    • Amino acids
      1 to 413

Specifications

Our Abpromise guarantee covers the use of ab152352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E2F 4
    • E2F transcription factor 4
    • E2F transcription factor 4 p107/p130 binding
    • E2F-4
    • E2F4
    • E2F4_HUMAN
    • p107/p130 binding protein
    • Transcription factor E2F 4
    • Transcription factor E2F4
    see all
  • Function
    Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F-4 binds with high affinity to RBL1 and RBL2. In some instances, can also bind RB protein.
  • Tissue specificity
    Found in all tissue examined including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the E2F/DP family.
  • Developmental stage
    Present in the growth-arrested state, its abundance does not change significantly as cells move into and through the cell cycle.
  • Post-translational
    modifications
    Differentially phosphorylated in vivo.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152352 stained with Coomassie Blue.

References

ab152352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up