Overview

  • Product nameRecombinant Human E2F6 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO75461
    • SpeciesHuman
    • SequenceMSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQY VSMRKALKVKRPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRK RRVYDITNVLDGIDLVEKKSKNHIRWIGSDLSNFGAVPQQKKLQEELSDL SAMEDALDELIKDCAQQLFELTDDKENERLAYVTYQDIHSIQAFHEQIVI AVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTSNKRSEG VGTSSSESTHPEGPEEEENPQQSEELLEVSN
    • Molecular weight57 kDa
    • Amino acids1 to 281

Specifications

Our Abpromise guarantee covers the use of ab114573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E2F 6
    • E2F binding site modulating activity protein
    • E2F transcription factor 6
    • E2F transcription factor 6 isoform 1
    • E2F-6
    • E2F6
    • E2F6_HUMAN
    • EMA
    • MGC111545
    • Transcription factor E2F6
    see all
  • FunctionInhibitor of E2F-dependent transcription. Binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3'. Has a preference for the 5'-TTTCCCGC-3' E2F recognition site. E2F-6 lacks the transcriptional activation and pocket protein binding domains. Appears to regulate a subset of E2F-dependent genes whose products are required for entry into the cell cycle but not for normal cell cycle progression. May silence expression via the recruitment of a chromatin remodeling complex containing histone H3-K9 methyltransferase activity. Overexpression delays the exit of cells from the S-phase.
  • Tissue specificityExpressed in all tissues examined. Highest levels in placenta, skeletal muscle, heart, ovary, kidney, small intestine and spleen.
  • Sequence similaritiesBelongs to the E2F/DP family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human E2F6 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human E2F6 protein (ab114573)

ab114573 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"