Overview

  • Product name
    Recombinant Human E2F8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQLAAICKMQLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELT APSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTP PQGLSPTVCTTHSSKATGSKDSTDATTEKAANDTSKASASTRPGSLLPAP ERQGAKSRTREPAGERGSKRASMLEDSGSKKKFKEDLKGLENVSATLFPS GYLIPLTQCSSLGAESILSGKENSSALSPNHRIYSSPIAGVIPVTSSELT AVNFPSFHVTPLKLMVSPTSVAAVPVGNSPALASSHPVPIQNPSSAIVNF TLQHLGLISPNVQLSASPGSGIVPVSPRIESVNVAPENAGTQQGRATNYD SPVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSS SCMDFEGANKTSLGTLFVPQRKLEVSTEDVH
    • Amino acids
      1 to 431
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E2F 8
    • E2F family member 82
    • E2F transcription factor 8
    • E2F-8
    • E2f8
    • E2F8_HUMAN
    • FLJ23311
    • Transcription factor E2F8
    see all
  • Function
    Along with E2F7, inhibitor of E2F-dependent transcription. Binds DNA independently of DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3'. Directly represses E2F1 transcription. Appears to regulate a subset of E2F-dependent genes whose products are required for normal cell cycle progession.
  • Sequence similarities
    Belongs to the E2F/DP family.
  • Domain
    Both DNA-binding domains are required for DNA-binding and are proposed to form an intramolecular structure that is similar to the winged helix structure of the E2F-DP heterodimer.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153513 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up