Recombinant Human E3 ubiquitin-protein ligase MUL1 (ab153508)

Overview

  • Product name
    Recombinant Human E3 ubiquitin-protein ligase MUL1
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKGAKKVHLGED LKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHK MVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDL GLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGE LVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFA TCATLFFILRKQYLQRQERLRLKQMQEEFQEHEAQLLSRAKPEDRESLKS ACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLY NS
    • Amino acids
      1 to 352
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 0610009K11Rik
    • AV000801
    • C1orf166
    • Chromosome 1 open reading frame 166
    • E3 SUMO-protein ligase MUL1
    • E3 ubiquitin ligase
    • E3 ubiquitin protein ligase MUL1
    • E3 ubiquitin-protein ligase MUL1
    • FLJ12875
    • GIDE
    • Growth inhibition and death E3 ligase
    • MAPL
    • Mitochondrial anchored protein ligase
    • mitochondrial E3 ubiquitin ligase 1
    • mitochondrial E3 ubiquitin protein ligase 1
    • Mitochondrial ubiquitin ligase activator of NFKB 1
    • Mitochondrial-anchored protein ligase
    • MUL1
    • MUL1_HUMAN
    • MULAN
    • Putative NF kappa B activating protein 266
    • Putative NF-kappa-B-activating protein 266
    • RGD1309944
    • RING finger protein 218
    • RNF218
    • RP11-401M16.2
    • RP23-25C1.10-002
    see all
  • Function
    Exhibits weak E3 ubiquitin-protein ligase activity, but preferentially acts as a SUMO E3 ligase at physiological concentrations. Plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
  • Tissue specificity
    Widely expressed with highest levels in the heart, skeletal muscle, placenta, kidney and liver. Barely detectable in colon and thymus.
  • Pathway
    Protein modification; protein ubiquitination.
    Protein modification; protein sumoylation.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Domain
    The zinc finger domain is required for E3 ligase activity.
  • Cellular localization
    Mitochondrion outer membrane. Peroxisome. Transported in mitochondrion-derived vesicles from the mitochondrion to the peroxisome.
  • Information by UniProt

Images

  • ab153508 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153508 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153508.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up