Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVG AVINNVSEAMETLTRITEELVPVPGS
    • Molecular weight
      34 kDa including tags
    • Amino acids
      162 to 237

Specifications

Our Abpromise guarantee covers the use of ab114209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EA6
    • EAA1_HUMAN
    • EAAT1
    • Excitatory amino acid transporter 1
    • FLJ25094
    • GLAST
    • GLAST-1
    • GLAST1
    • Glial high affinity glutamate transporter
    • glutamate/aspartate transporter, high affinity, sodium-dependent
    • High affinity neuronal glutamate transporter
    • Slc1a3
    • Sodium dependent glutamate/aspartate transporter
    • Sodium-dependent glutamate/aspartate transporter 1
    • Solute carrier family 1 (glial high affinity glutamate transporter) member 3
    • Solute carrier family 1 member 3
    see all
  • Function
    Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.
  • Tissue specificity
    Highly expressed in cerebellum, but also found in frontal cortex, hippocampus and basal ganglia.
  • Involvement in disease
    Defects in SLC1A3 are the cause of episodic ataxia type 6 (EA6) [MIM:612656]. EA6 is characterized by episodic ataxia, seizures, migraine and alternating hemiplegia.
  • Sequence similarities
    Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A3 subfamily.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human EAAT1 protein images

  • 12.5% SDS-PAGE analysis of ab114209 stained with Coomassie Blue.

References for Recombinant Human EAAT1 protein (ab114209)

ab114209 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114209.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up