Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLT VFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISS LITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLK KQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPP PDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFI AFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAG IFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDG TALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTM LLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSE LDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDEC KVTLAANGKSADCSVEEEPWKREK
    • Amino acids
      1 to 574
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab159514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EAA2_HUMAN
    • EAAT2
    • Excitatory amino acid transporter 2
    • Excitotoxic amino acid transporter 2
    • Glial high affinity glutamate transporter
    • GLT 1
    • GLT1
    • Glutamate aspartate transporter II
    • Glutamate transporter 1
    • Glutamate/aspartate transporter II
    • Slc1a2
    • Sodium dependent glutamate aspartate transporter 2
    • Sodium-dependent glutamate/aspartate transporter 2
    • solute carrier family 1 (glial high affinity glutamate transporter), member 2
    • Solute carrier family 1 glial high affinity glutamate transporter member 2
    • Solute carrier family 1 member 2
    see all
  • Function
    Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.
  • Sequence similarities
    Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A2 subfamily.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159514 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up