Overview

  • Product name
    Recombinant Human EAAT4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPYKSLMAQ EKGASRGRGGNESAM
    • Amino acids
      500 to 564
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Excitatory amino acid transporter 4
    • High affinity neuronal glutamate transporter
    • MGC33092
    • MGC43671
    • Sodium dependent glutamate/aspartate transporter
    • Solute carrier family 1 (high affinity aspartate/glutamate transporter) member 6
    • Solute carrier family 1 member 6
    see all
  • Relevance
    EAAT4 is expressed predominantly in the cerebellum (Purkinje cells) and weakly in the forebrain, where it transports L-glutamate, L-aspartate and D-aspartate, acting as a symport by cotransporting sodium. EAAT4 may function as a combined transporter and inhibitory glutamate receptor and also functions as an anion-selective ion channel.
  • Cellular localization
    Membrane; multi-pass membrane protein.

Images

  • ab159517 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up