Overview

  • Product name
    Recombinant Human EAF2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGY LEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRL EKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKM SPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDE DCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQ LSESGSDSDD
    • Amino acids
      1 to 260
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163250 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BM 040
    • BM040
    • EAF 2
    • EAF2
    • EAF2_HUMAN
    • Ehrlich S II transcriptional activator factor
    • ELL associated factor 2
    • ELL-associated factor 2
    • Festa
    • Testosterone regulated apoptosis inducer and tumor suppressor
    • Testosterone regulated apoptosis inducer and tumor suppressor protein
    • Testosterone-regulated apoptosis inducer and tumor suppressor protein
    • TRAITS
    • U19
    • Uncharacterized bone marrow protein BM 040
    • Uncharacterized bone marrow protein BM040
    see all
  • Function
    Acts as a transcriptional transactivator of TCEA1 elongation activity (By similarity). Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibits prostate tumor growth in vivo.
  • Tissue specificity
    Expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine, colon, adrenal, bone marrow, lymph node, spinal gland, stomach, thyroid, trachea, thymus, liver and leukocytes.
  • Sequence similarities
    Belongs to the EAF family.
  • Cellular localization
    Nucleus speckle. Colocalizes with ELL to nuclear speckles.
  • Information by UniProt

Images

  • ab163250 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163250 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163250.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up