Overview

  • Product nameRecombinant Human EB2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15555
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPGPTQTLSPNGENNNDIIQDNNGTIIPFR KHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQ LCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNV DKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIP PPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSS GSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQ EHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
    • Molecular weight39 kDa including tags
    • Amino acids1 to 327
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab113592 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • APC binding protein EB1
    • APC binding protein EB2
    • APC-binding protein EB2
    • EB1
    • EB2
    • End binding protein 2
    • End-binding protein 2
    • H.sapiens mRNA for novel T cell activation protein
    • MAPRE2
    • MARE2_HUMAN
    • Microtubule associated protein RP/EB family member 2
    • Microtubule-associated protein RP/EB family member 2
    • RP1
    • T cell activation protein EB1 family
    see all
  • FunctionMay be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.
  • Tissue specificityExpressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes.
  • Sequence similaritiesBelongs to the MAPRE family.
    Contains 1 CH (calponin-homology) domain.
    Contains 1 EB1 C-terminal domain.
  • DomainComposed of two functionally independent domains. The N-terminal domain forms an hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.
  • Cellular localizationCytoplasm > cytoskeleton. Associated with the microtubule network. Accumulates at the plus end of microtubules.
  • Information by UniProt

Recombinant Human EB2 protein images

  • 15% SDS-PAGE analysis of ab113592 (3µg)

References for Recombinant Human EB2 protein (ab113592)

ab113592 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"