Overview

  • Product name
    Recombinant Human EB2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPGPTQTLSPNGENNNDIIQDNNGTIIPFR KHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQ LCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNV DKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIP PPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSS GSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQ EHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 327
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab113592 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • APC binding protein EB1
    • APC binding protein EB2
    • APC-binding protein EB2
    • EB1
    • EB2
    • End binding protein 2
    • End-binding protein 2
    • H.sapiens mRNA for novel T cell activation protein
    • MAPRE2
    • MARE2_HUMAN
    • Microtubule associated protein RP/EB family member 2
    • Microtubule-associated protein RP/EB family member 2
    • RP1
    • T cell activation protein EB1 family
    see all
  • Function
    May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.
  • Tissue specificity
    Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes.
  • Sequence similarities
    Belongs to the MAPRE family.
    Contains 1 CH (calponin-homology) domain.
    Contains 1 EB1 C-terminal domain.
  • Domain
    Composed of two functionally independent domains. The N-terminal domain forms an hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.
  • Cellular localization
    Cytoplasm > cytoskeleton. Associated with the microtubule network. Accumulates at the plus end of microtubules.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab113592 (3µg)

References

ab113592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up