Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV SFIATYRL GMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSF VP FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYW IRYKRQGAARFHRV GPIEATSFILRAVRPRARYYVQVAAQDLTDYGEL SDWSLPATATMSLGK
    • Amino acids
      21 to 229
    • Tags
      His tag N-Terminus
    • Additional sequence information
      This aa sequence represents the mature full length minus the signal peptide from aa 1 to 20. The His tag is a hexahistidine tag.

Specifications

Our Abpromise guarantee covers the use of ab83026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.

    Preservative: None
    Constituents: 50% Glycerol, PBS, pH 7.2

General Info

  • Alternative names
    • cytokine receptor
    • EBI3
    • EBV induced gene 3 protein
    • EBV-induced gene 3 protein
    • Epstein Barr virus induced 3
    • Epstein Barr virus induced gene 3
    • Epstein Barr virus induced gene 3 protein
    • Epstein-Barr virus-induced gene 3 protein
    • IL 27 subunit beta
    • IL 27B
    • IL-27 subunit beta
    • IL-27B
    • IL27 subunit
    • IL27 subunit beta
    • IL27B
    • IL27B_HUMAN
    • IL35 subunit
    • interleukin 27 subunit beta
    • Interleukin-27 subunit beta
    see all
  • Function
    Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 3 subfamily.
    Contains 2 fibronectin type-III domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human EBI3 protein images

  • SDS-PAGE showing ab83026.

  • Anti-EBI3 antibody (ab72330) at 2 µg/ml (Sample: ab83026, 0.1 ug)

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

References for Recombinant Human EBI3 protein (ab83026)

ab83026 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up