Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ14213
    • SpeciesHuman
    • SequenceRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV SFIATYRL GMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSF VP FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYW IRYKRQGAARFHRV GPIEATSFILRAVRPRARYYVQVAAQDLTDYGEL SDWSLPATATMSLGK
    • Amino acids21 to 229
    • TagsHis tag N-Terminus
    • Additional sequence informationThis aa sequence represents the mature full length minus the signal peptide from aa 1 to 20. The His tag is a hexahistidine tag.

Specifications

Our Abpromise guarantee covers the use of ab83026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity> 95 % by SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.

    Preservative: None
    Constituents: 50% Glycerol, PBS, pH 7.2

General Info

  • Alternative names
    • cytokine receptor
    • EBI3
    • EBV induced gene 3 protein
    • EBV-induced gene 3 protein
    • Epstein Barr virus induced 3
    • Epstein Barr virus induced gene 3
    • Epstein Barr virus induced gene 3 protein
    • Epstein-Barr virus-induced gene 3 protein
    • IL 27 subunit beta
    • IL 27B
    • IL-27 subunit beta
    • IL-27B
    • IL27 subunit
    • IL27 subunit beta
    • IL27B
    • IL27B_HUMAN
    • IL35 subunit
    • interleukin 27 subunit beta
    • Interleukin-27 subunit beta
    see all
  • Information by UniProt

Recombinant Human EBI3 protein images

  • SDS-PAGE showing ab83026.

  • Anti-EBI3 antibody (ab72330) at 2 µg/ml (Sample: ab83026, 0.1 ug)

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    developed using the ECL technique

    Performed under reducing conditions.

References for Recombinant Human EBI3 protein (ab83026)

ab83026 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"