Overview

  • Product nameRecombinant Human ECH1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ13011
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMTGSSAQEAASGVALGEAPDHSYESLRVTS AQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGK MFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKP VIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRL PKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAA EISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQ ATTENKELKTVTFSKL
    • Molecular weight34 kDa including tags
    • Amino acids34 to 328
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101154 was purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 4)-dienoyl-CoA isomerase
    • 5)-Delta(2
    • Delta(3
    • Delta(3 5) Delta(2 4) dienoyl CoA isomerase
    • Delta(3 5) Delta(2 4) dienoyl CoA isomerase mitochondrial
    • Delta3 5 delta2 4 dienoyl CoA isomerase
    • Dienoyl CoA isomerase
    • ECH 1
    • Ech1
    • ECH1_HUMAN
    • Enoyl Coenzyme A hydratase 1
    • Enoyl Coenzyme A hydratase 1 peroxisomal
    • HPXEL
    • mitochondrial
    • MS1034
    • Peroxisomal enoyl CoA hydratase 1
    • Peroxisomal enoyl coenzyme A hydratase like protein
    see all
  • FunctionIsomerization of 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA.
  • PathwayLipid metabolism; fatty acid beta-oxidation.
  • Sequence similaritiesBelongs to the enoyl-CoA hydratase/isomerase family.
  • Cellular localizationMitochondrion. Peroxisome.
  • Information by UniProt

Recombinant Human ECH1 protein images

  • 15% SDS-PAGE analysis of ab101154 (3µg)

References for Recombinant Human ECH1 protein (ab101154)

ab101154 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"