Overview

  • Product name
    Recombinant Human ECH1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTGSSAQEAASGVALGEAPDHSYESLRVTS AQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGK MFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKP VIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRL PKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAA EISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQ ATTENKELKTVTFSKL
    • Molecular weight
      34 kDa including tags
    • Amino acids
      34 to 328
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101154 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 4)-dienoyl-CoA isomerase
    • 5)-Delta(2
    • Delta(3
    • Delta(3 5) Delta(2 4) dienoyl CoA isomerase
    • Delta(3 5) Delta(2 4) dienoyl CoA isomerase mitochondrial
    • Delta3 5 delta2 4 dienoyl CoA isomerase
    • Dienoyl CoA isomerase
    • ECH 1
    • Ech1
    • ECH1_HUMAN
    • Enoyl Coenzyme A hydratase 1
    • Enoyl Coenzyme A hydratase 1 peroxisomal
    • HPXEL
    • mitochondrial
    • MS1034
    • Peroxisomal enoyl CoA hydratase 1
    • Peroxisomal enoyl coenzyme A hydratase like protein
    see all
  • Function
    Isomerization of 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA.
  • Pathway
    Lipid metabolism; fatty acid beta-oxidation.
  • Sequence similarities
    Belongs to the enoyl-CoA hydratase/isomerase family.
  • Cellular localization
    Mitochondrion. Peroxisome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab101154 (3µg)

References

ab101154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up