Overview

  • Product nameRecombinant Human ECHS1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP30084
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASGANFEYIIAEKRGKNNTVGLIQLNRPK ALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNL SFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGE KAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQA GLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGS KLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
    • Molecular weight31 kDa including tags
    • Amino acids28 to 290
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab100962 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C80529
    • EC 4.2.1.17
    • ECHS 1
    • Enoyl CoA hydratase 1
    • Enoyl CoA hydratase mitochondrial
    • Enoyl CoA hydratase short chain 1 mitochondrial
    • Enoyl Coenzyme A hydratase short chain 1
    • Enoyl Coenzyme A hydratase short chain 1 mitochondrial
    • Mitochondrial short chain enoyl coenzyme A hydratase 1
    • OTTHUMP00000020811
    • SCEH
    • Short chain enoyl CoA hydratase
    see all
  • RelevanceECHS1 (Enoyl Coenzyme A hydratase, short chain, 1) catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs, in the second step of the mitochondrial fatty acid beta-oxidation pathway.
  • Cellular localizationMitochondrion matrix.

Recombinant Human ECHS1 protein images

  • 15% SDS-PAGE showing ab100962 (3 µg) at approximately 30.6 kDa.

References for Recombinant Human ECHS1 protein (ab100962)

ab100962 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab100962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"