Overview

  • Product name
    Recombinant Human Eco1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKV VGCLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICG ISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLF ATQYCGTGQFLVYNFINGQNST
    • Amino acids
      1 to 172
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A930014I12Rik
    • CTF
    • CTF7 homolog 1
    • CTF7, S. cerevisiae, homolog of, 1
    • ECO1
    • ECO1 homolog 1
    • ECO1, S. cerevisiae, homolog of, 1
    • EFO1
    • EFO1p
    • ESCO1
    • ESCO1_HUMAN
    • ESO1
    • ESO1 homolog 1
    • ESO1, S. pombe, homolog of, 1
    • Establishment factor like protein 1
    • Establishment factor ortholog 1
    • Establishment factor-like protein 1
    • Establishment of cohesion 1 homolog 1
    • Establishment of cohesion 1, S. cerevisiae, homolog of
    • establishment of sister chromatid cohesion N-acetyltransferase 1
    • hEFO1
    • HGNC:24645
    • KIAA1911
    • N acetyltransferase ESCO1
    • N-acetyltransferase ESCO1
    see all
  • Function
    Acetyltransferase required for the establishment of sister chromatid cohesion and couple the processes of cohesion and DNA replication to ensure that only sister chromatids become paired together. In contrast to the structural cohesins, the deposition and establishment factors are required only during S phase. Acts by mediating the acetylation of cohesin component SMC3.
  • Tissue specificity
    Widely expressed. Expressed in heart, brain, liver, placenta, lung, kidney and pancreas. Highly expressed in muscle.
  • Sequence similarities
    Belongs to the acetyltransferase family. GCN5 subfamily.
  • Domain
    The N-terminal region seems to be responsible for the association with chromosomes, thus excluding any involvement of the Zn finger in this process.
  • Post-translational
    modifications
    Phosphorylated during mitosis. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Chromosome. Nuclear at interphase, associated with chromosomes during mitosis.
  • Information by UniProt

Images

  • ab165040 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up