Overview

  • Product name
    Recombinant Human EDEM3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGGFKYGDEQPRSDWRSYRRNLEHAVLELTLFKTVPSKMEIHSSPFKCST APPCNTSGQGKITEHSCEPDFCCLWIDKKQNSFSSGVGNRSLDSLLIKGS SPFLVLGVRGSFGKMHPSIVAF
    • Amino acids
      1 to 122
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • alpha-1,2-mannosidase EDEM3
    • C1orf22
    • EDEM 3
    • edem3
    • EDEM3_HUMAN
    • ER degradation enhancer, mannosidase alpha like 3
    • ER degradation enhancing alpha mannosidase like 3
    • ER degradation enhancing alpha mannosidase like protein 3
    • ER degradation-enhancing alpha-mannosidase-like 3
    see all
  • Function
    Involved in endoplasmic reticulum-associated degradation (ERAD). Accelerates the glycoprotein ERAD by proteasomes. This process depends on mannose-trimming from the N-glycans. Seems to have alpha 1,2-mannosidase activity.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 47 family.
    Contains 1 PA (protease associated) domain.
  • Domain
    Contains a protease-associated domain (PA) of unknown function.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • ab164239 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164239 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up