Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 47

Specifications

Our Abpromise guarantee covers the use of ab114275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD363
    • CHEDG 1
    • CHEDG1
    • D1S3362
    • ECGF 1
    • ECGF1
    • EDG 1
    • EDG1
    • endothelial differentiation G protein coupled receptor 1
    • Endothelial differentiation G-protein coupled receptor 1
    • Endothelial differentiation sphingolipid G protein coupled receptor 1
    • FLJ58121
    • G protein coupled sphingolipid receptor
    • g protein-coupled receptor edg-1
    • S1P receptor 1
    • S1P receptor Edg 1
    • S1P receptor Edg-1
    • S1P receptor Edg1
    • S1P(1) receptor
    • S1P1
    • s1pr1
    • S1PR1_HUMAN
    • sphingolipid g-protein-coupled receptor 1
    • Sphingosine 1 phosphate receptor Edg 1
    • Sphingosine 1 phosphate receptor EDG1
    • sphingosine 1- phosphate receptor 1
    • Sphingosine 1-phosphate receptor 1
    • Sphingosine 1-phosphate receptor Edg-1
    • Sphingosine 1phosphate receptor type 1 S1P1
    see all
  • Function
    Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. This inducible epithelial cell G-protein-coupled receptor may be involved in the processes that regulate the differentiation of endothelial cells. Seems to be coupled to the G(i) subclass of heteromeric G proteins.
  • Tissue specificity
    Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    S1P-induced endothelial cell migration requires the PKB/AKT1-mediated phosphorylation of the third intracellular loop at the Thr-236 residue.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab114275 stained with Coomassie Blue.

References

ab114275 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114275.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up