Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSK LVMGLGITVCIFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGL AYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITV FRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAP LYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNR DTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNH TILAGVHSNDHSVV
    • Molecular weight
      68 kDa including tags
    • Amino acids
      1 to 364

Specifications

Our Abpromise guarantee covers the use of ab152354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5031439C20
    • AI326300
    • EDG 2
    • Endothelial differentiation gene 2
    • Endothelial differentiation, lysophosphatidic acid G protein coupled receptor, 2
    • GPCR 26
    • Gpcr26
    • Gpcr91
    • GPR26
    • Kdt2
    • LPA 1
    • LPA receptor 1
    • LPA receptor EDG2
    • LPA-1
    • lpA1
    • Lpar1
    • LPAR1_HUMAN
    • Lysophosphatidic acid receptor 1
    • Lysophosphatidic acid receptor Edg-2
    • Lysophosphatidic acid receptor EDG2
    • MGC105279
    • MGC29102
    • Mrec1.3
    • rec.1.3
    • Ventricular zone gene 1
    • vzg-1
    • VZG1
    see all
  • Function
    Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Stimulates phospholipase C (PLC) activity in a manner that is dependent on RALA activation.
  • Tissue specificity
    Expressed in many adult organs, including brain, heart, colon, small intestine, placenta, prostate, ovary, pancreas, testes, spleen, skeletal muscle, and kidney. Little or no expression in liver, lung, thymus, or peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell surface. Cell membrane. Prior to LPA treatment found predominantly at the cell surface but in the presence of LPA co-localizes with RALA in the endocytic vesicles.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152354 stained with Coomassie Blue.

References

ab152354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up