Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKV KEDLPHTAPSSCIMDKNAALQNGIFCN
    • Molecular weight
      34 kDa including tags
    • Amino acids
      302 to 378

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EDG 3
    • EDG3
    • Endothelial differentiation G protein coupled receptor 3
    • Endothelial differentiation G-protein coupled receptor 3
    • Endothelial differentiation gene 3
    • Endothelial differentiation sphingolipid G protein coupled receptor 3
    • FLJ37523
    • FLJ93220
    • G protein coupled receptor endothelial differentiation gene 3
    • LPB 3
    • LPB3
    • MGC71696
    • OTTHUMP00000215691
    • S1P receptor 3
    • S1P receptor Edg 3
    • S1P receptor Edg-3
    • S1P receptor EDG3
    • S1P3
    • S1pr3
    • S1PR3_HUMAN
    • Sphingosine 1 phosphate receptor 3
    • Sphingosine 1 phosphate receptor Edg 3
    • Sphingosine 1 phosphate receptor Edg3
    • Sphingosine 1-phosphate receptor 3
    • Sphingosine 1-phosphate receptor Edg-3
    see all
  • Function
    Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis.
  • Tissue specificity
    Expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human EDG3 protein images

  • ab114632 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human EDG3 protein (ab114632)

ab114632 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up