Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKV KEDLPHTAPSSCIMDKNAALQNGIFCN
    • Molecular weight
      34 kDa including tags
    • Amino acids
      302 to 378

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EDG 3
    • EDG3
    • Endothelial differentiation G protein coupled receptor 3
    • Endothelial differentiation G-protein coupled receptor 3
    • Endothelial differentiation gene 3
    • Endothelial differentiation sphingolipid G protein coupled receptor 3
    • FLJ37523
    • FLJ93220
    • G protein coupled receptor endothelial differentiation gene 3
    • LPB 3
    • LPB3
    • MGC71696
    • OTTHUMP00000215691
    • S1P receptor 3
    • S1P receptor Edg 3
    • S1P receptor Edg-3
    • S1P receptor EDG3
    • S1P3
    • S1pr3
    • S1PR3_HUMAN
    • Sphingosine 1 phosphate receptor 3
    • Sphingosine 1 phosphate receptor Edg 3
    • Sphingosine 1 phosphate receptor Edg3
    • Sphingosine 1-phosphate receptor 3
    • Sphingosine 1-phosphate receptor Edg-3
    see all
  • Function
    Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis.
  • Tissue specificity
    Expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114632 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up