Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVA SDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHC QHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEG GIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWI QINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTN EDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCEL SGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNA WTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDG EHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGR ITLRSELLGCTEEEVDHHHHHH
    • Molecular weight
      53 kDa including tags
    • Amino acids
      17 to 480
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/mg
  • Purity
    >95% by SDS-PAGE .
    ab152047 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Lyophilized from a 0.2 µM filtered solution. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • DEL1
    • Developmental endothelial locus 1
    • Developmentally regulated endothelial cell locus 1 protein
    • Developmentally-regulated endothelial cell locus 1 protein
    • Edil3
    • EDIL3_HUMAN
    • EGF like repeat and discoidin I like domain containing protein 3
    • EGF like repeats and discoidin I like domains 3
    • EGF like repeats and discoidin I like domains protein 3
    • EGF-like repeat and discoidin I-like domain-containing protein 3
    • Integrin binding protein DEL1
    • Integrin-binding protein DEL1
    see all
  • Function
    Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.
  • Sequence similarities
    Contains 3 EGF-like domains.
    Contains 2 F5/8 type C domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab152047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up