Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCEC PDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTF IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFM GRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKG LINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAY SNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQV CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFT WEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFG HVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPP IYARHIRILPWSWYGRITLRSELLGCTEEE
    • Amino acids
      1 to 480
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab160806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DEL1
    • Developmental endothelial locus 1
    • Developmentally regulated endothelial cell locus 1 protein
    • Developmentally-regulated endothelial cell locus 1 protein
    • Edil3
    • EDIL3_HUMAN
    • EGF like repeat and discoidin I like domain containing protein 3
    • EGF like repeats and discoidin I like domains 3
    • EGF like repeats and discoidin I like domains protein 3
    • EGF-like repeat and discoidin I-like domain-containing protein 3
    • Integrin binding protein DEL1
    • Integrin-binding protein DEL1
    see all
  • Function
    Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.
  • Sequence similarities
    Contains 3 EGF-like domains.
    Contains 2 F5/8 type C domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab160806 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up