Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMAC GKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1312 to 1411

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    This product is useful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    ab112379 is best used within three months from the date of receipt.This product is useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Early endosome antigen 1
    • Early endosome antigen 1, 162kD
    • Early endosome associated protein
    • EEA 1
    • EEA1
    • EEA1_HUMAN
    • Endosome associated protein p162
    • Endosome-associated protein p162
    • MST105
    • MSTP105
    • ZFYVE2
    • Zinc finger FYVE domain containing protein 2
    • Zinc finger FYVE domain-containing protein 2
    see all
  • Function
    Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in endosomal trafficking.
  • Sequence similarities
    Contains 1 C2H2-type zinc finger.
    Contains 1 FYVE-type zinc finger.
  • Domain
    The FYVE-type zinc finger domain mediates interactions with phosphatidylinositol 3-phosphate in membranes of early endosomes and penetrates bilayers. The FYVE domain insertion into PtdIns(3)P-enriched membranes is substantially increased in acidic conditions.
  • Cellular localization
    Cytoplasm. Early endosome membrane.
  • Information by UniProt

Recombinant Human EEA1 protein images

  • ab112379 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue

References for Recombinant Human EEA1 protein (ab112379)

ab112379 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up