Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMAC GKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1312 to 1411

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    This product is useful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    ab112379 is best used within three months from the date of receipt.This product is useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Early endosome antigen 1
    • Early endosome antigen 1, 162kD
    • Early endosome associated protein
    • EEA 1
    • EEA1
    • EEA1_HUMAN
    • Endosome associated protein p162
    • Endosome-associated protein p162
    • MST105
    • MSTP105
    • ZFYVE2
    • Zinc finger FYVE domain containing protein 2
    • Zinc finger FYVE domain-containing protein 2
    see all
  • Function
    Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in endosomal trafficking.
  • Sequence similarities
    Contains 1 C2H2-type zinc finger.
    Contains 1 FYVE-type zinc finger.
  • Domain
    The FYVE-type zinc finger domain mediates interactions with phosphatidylinositol 3-phosphate in membranes of early endosomes and penetrates bilayers. The FYVE domain insertion into PtdIns(3)P-enriched membranes is substantially increased in acidic conditions.
  • Cellular localization
    Cytoplasm. Early endosome membrane.
  • Information by UniProt

Images

  • ab112379 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue

References

ab112379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up