Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO75530
    • SpeciesHuman
    • SequenceKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDL EVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR
    • Molecular weight37 kDa including tags
    • Amino acids342 to 441

Specifications

Our Abpromise guarantee covers the use of ab112381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityUseful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesab112381 is best used within three months from the date of receipt.Useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • eed
    • EED protein
    • EED, mouse, homolog of
    • EED_HUMAN
    • Embryonic ectoderm development
    • Embryonic ectoderm development isoform a
    • Embryonic ECTODERM development protein homolog
    • Embryonic ectoderm development protein, mouse, homolog of
    • hEED
    • OTTHUMP00000235483
    • OTTHUMP00000235484
    • OTTHUMP00000235485
    • Polycomb protein eed
    • WAIT 1
    • WAIT-1
    • WAIT1
    • WD protein associating with integrin cytoplasmic tails 1
    see all
  • FunctionPolycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.
  • Tissue specificityExpressed in brain, colon, heart, kidney, liver, lung, muscle, ovary, peripheral blood leukocytes, pancreas, placenta, prostate, spleen, small intestine, testis, thymus and uterus. Appears to be overexpressed in breast and colon cancer.
  • Sequence similaritiesBelongs to the WD repeat ESC family.
    Contains 7 WD repeats.
  • Developmental stageExpression peaks at the G1/S phase boundary.
  • Cellular localizationNucleus. Chromosome. Transiently colocalizes with XIST at inactive X chromosomes.
  • Information by UniProt

Recombinant Human EED protein images

  • ab112381 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human EED protein (ab112381)

ab112381 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"