Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTE RPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQF NWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCA WTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPR DPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKI MSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFST RDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVT ILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKC TTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR
    • Molecular weight
      51 kDa including tags
    • Amino acids
      2 to 441
    • Tags
      DDDDK tag N-Terminus
    • Additional sequence information
      This product is for the mature full length protein from aa 2 to 441. The initial Met is not included. GenBank Accession No. NM_003797

Specifications

Our Abpromise guarantee covers the use of ab196104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >= 50 % SDS-PAGE.

  • Form
    Liquid
  • Additional notes

    Useful for binding studies to investigate protein-protein interactions in the EZH2 complex. Also suitable as an immunogen or as a standard for Western blotting.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.71% Tris HCl, 10% Glycerol, 0.17% Sodium chloride

General Info

  • Alternative names
    • eed
    • EED protein
    • EED, mouse, homolog of
    • EED_HUMAN
    • Embryonic ectoderm development
    • Embryonic ectoderm development isoform a
    • Embryonic ECTODERM development protein homolog
    • Embryonic ectoderm development protein, mouse, homolog of
    • hEED
    • OTTHUMP00000235483
    • OTTHUMP00000235484
    • OTTHUMP00000235485
    • Polycomb protein eed
    • WAIT 1
    • WAIT-1
    • WAIT1
    • WD protein associating with integrin cytoplasmic tails 1
    see all
  • Function
    Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.
  • Tissue specificity
    Expressed in brain, colon, heart, kidney, liver, lung, muscle, ovary, peripheral blood leukocytes, pancreas, placenta, prostate, spleen, small intestine, testis, thymus and uterus. Appears to be overexpressed in breast and colon cancer.
  • Sequence similarities
    Belongs to the WD repeat ESC family.
    Contains 7 WD repeats.
  • Developmental stage
    Expression peaks at the G1/S phase boundary.
  • Cellular localization
    Nucleus. Chromosome. Transiently colocalizes with XIST at inactive X chromosomes.
  • Information by UniProt

Images

  • 4-20% SDS Page analysis of ab196104 (2.3 μg)

References

ab196104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up