Overview

  • Product nameRecombinant Human EEF1D protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP29692
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMATNFLAHEKIWFDKFKYDDAERRFYEQMN GPVAGASRQENGASVILRDIARARENIQKSLAGSSGPGASSGTSGDHGEL VVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRATAPQTQ HVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLR QYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGA SKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNK I
    • Molecular weight33 kDa including tags
    • Amino acids1 to 281
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104755 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Antigen NY CO 4
    • Antigen NY-CO-4
    • EEF 1D
    • EEF1D
    • EF 1 delta
    • EF 1D
    • EF-1-delta
    • EF1D
    • EF1D_HUMAN
    • Elongation factor 1 delta
    • Elongation factor 1-delta
    • Eukaryotic translation elongation factor 1 delta
    • eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein)
    • FP1047
    • Guanine nucleotide exchange protein
    see all
  • FunctionIsoform 1: EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP, regenerating EF-1-alpha for another round of transfer of aminoacyl-tRNAs to the ribosome.
    Isoform 2: Regulates induction of heat-shock-responsive genes through association with heat shock transcription factors and direct DNA-binding at heat shock promoter elements (HSE).
  • Tissue specificityIsoform 2 is specifically expressed in brain, cerebellum and testis.
  • Sequence similaritiesBelongs to the EF-1-beta/EF-1-delta family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human EEF1D protein images

  • 15% SDS-PAGE (3µg).
    Note: Molecular weight on SDS-PAGE will appear higher than predicted.

References for Recombinant Human EEF1D protein (ab104755)

ab104755 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"