Recombinant Human EFCAB4B protein (ab164657)

Overview

  • Product name
    Recombinant Human EFCAB4B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLV MLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADG NGYLTPQEFTTGFSHFFFSQNNPSQEDAGEQVAQRHEEKVYLSRGDEDLG DMGEDEEAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLSNFEDF LTRIISQLQEAHEEKNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQ FLLKDTERFQARSQELEQKLLCKEQELEQLTQKQKRLEGQCTALHHDKHE TKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEME VYRVTESLQREKAGLLKQLDFLRCVGGHWPVLRAPPRSLGSEGPV
    • Amino acids
      1 to 395
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium release-activated calcium channel regulator 2A
    • CRAC channel regulator 2A
    • CRACR2A
    • EF hand calcium binding domain 4B
    • EF hand calcium binding domain containing protein 4B
    • EF-hand calcium-binding domain-containing protein 4B
    • EFC4B_HUMAN
    • EFCAB 4B
    • Efcab4b
    • FLJ33805
    • MGC4266
    see all
  • Function
    Ca(2+)-binding protein that plays a key role in store-operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation. Acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca(2+) concentration. It thereby regulates CRAC channel activation, including translocation and clustering of ORAI1 and STIM1. Upon increase of cytoplasmic Ca(2+) resulting from opening of CRAC channels, dissociates from ORAI1 and STIM1, thereby destabilizing the ORAI1-STIM1 complex.
  • Sequence similarities
    Belongs to the EFCAB4 family.
    Contains 2 EF-hand domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab164657 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164657 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164657.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up