Recombinant Human EFEMP1 protein (ab114651)

Overview

  • Product nameRecombinant Human EFEMP1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ12805
    • SpeciesHuman
    • SequenceMLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVGQQCKDIDECDI VPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTG VVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIRRNPADPQRIP SNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQ CPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAANNY TCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMC WNYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSI RSDRSVPSDIFQIQATTIYANTINTFRIKSGSENGEFYLRQTSPVSAMLV LVKSLSGPREHIVDLEMLTASSIGTFRTSSVLRLTIIVGPFSF
    • Molecular weight80 kDa including tags
    • Amino acids1 to 493

Specifications

Our Abpromise guarantee covers the use of ab114651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DHRD
    • Doyne honeycomb retinal degeneration
    • DRAD
    • EFEMP 1
    • EFEMP1
    • EGF containing fibulin like extracellular matrix protein 1
    • EGF containing fibulin like extracellular matrix protein 1 precursor
    • EGF-containing fibulin-like extracellular matrix protein 1
    • Epidermal growth factor containing fibulin like extracellular matrix protein 1
    • Extracellular protein S1 5
    • Extracellular protein S1-5
    • FBLN 3
    • FBLN3
    • FBLN3_HUMAN
    • FBNL
    • FIBL 3
    • FIBL-3
    • FIBL3
    • Fibrillin like
    • Fibrillin like protein
    • Fibrillin-like protein
    • FIBULIN 3
    • Fibulin-3
    • Fibulin3
    • FLJ35535
    • Heat shock 70 KD protein 1
    • MGC111353
    • MLVT
    • MTLV
    • S1 5
    • T16 protein
    see all
  • FunctionBinds EGFR, the EGF receptor, inducing EGFR autophosphorylation and the activation of downstream signaling pathways. May play a role in cell adhesion and migration. May function as a negative regulator of chondrocyte differentiation. In the olfactory epithelium, it may regulate glial cell migration, differentiation and the ability of glial cells to support neuronal neurite outgrowth.
  • Tissue specificityIn the eye, associated with photoreceptor outer and inner segment regions, the nerve fiber layer, outer nuclear layer and inner and outer plexiform layers of the retina.
  • Involvement in diseaseDefects in EFEMP1 are a cause of Doyne honeycomb retinal dystrophy (DHRD) [MIM:126600]; also known as malattia leventinese (MLVT) (ML). DHRD is an autosomal dominant disease characterized by yellow-white deposits known as drusen that accumulate beneath the retinal pigment epithelium.
  • Sequence similaritiesBelongs to the fibulin family.
    Contains 6 EGF-like domains.
  • Cellular localizationSecreted > extracellular space. Secreted > extracellular space > extracellular matrix. Localizes to the lamina propria underneath the olfactory epithelium.
  • Information by UniProt

Recombinant Human EFEMP1 protein images

  • 12.5% SDS-PAGE showing ab114651 at approximately 79.97kDa stained with Coomassie Blue.

References for Recombinant Human EFEMP1 protein (ab114651)

ab114651 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"