Recombinant Human EFEMP1 protein (ab114651)

Overview

  • Product name
    Recombinant Human EFEMP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVGQQCKDIDECDI VPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTG VVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIRRNPADPQRIP SNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQ CPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAANNY TCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMC WNYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSI RSDRSVPSDIFQIQATTIYANTINTFRIKSGSENGEFYLRQTSPVSAMLV LVKSLSGPREHIVDLEMLTASSIGTFRTSSVLRLTIIVGPFSF
    • Molecular weight
      80 kDa including tags
    • Amino acids
      1 to 493

Specifications

Our Abpromise guarantee covers the use of ab114651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DHRD
    • Doyne honeycomb retinal degeneration
    • DRAD
    • EFEMP 1
    • EFEMP1
    • EGF containing fibulin like extracellular matrix protein 1
    • EGF containing fibulin like extracellular matrix protein 1 precursor
    • EGF-containing fibulin-like extracellular matrix protein 1
    • Epidermal growth factor containing fibulin like extracellular matrix protein 1
    • Extracellular protein S1 5
    • Extracellular protein S1-5
    • FBLN 3
    • FBLN3
    • FBLN3_HUMAN
    • FBNL
    • FIBL 3
    • FIBL-3
    • FIBL3
    • Fibrillin like
    • Fibrillin like protein
    • Fibrillin-like protein
    • FIBULIN 3
    • Fibulin-3
    • Fibulin3
    • FLJ35535
    • Heat shock 70 KD protein 1
    • MGC111353
    • MLVT
    • MTLV
    • S1 5
    • T16 protein
    see all
  • Function
    Binds EGFR, the EGF receptor, inducing EGFR autophosphorylation and the activation of downstream signaling pathways. May play a role in cell adhesion and migration. May function as a negative regulator of chondrocyte differentiation. In the olfactory epithelium, it may regulate glial cell migration, differentiation and the ability of glial cells to support neuronal neurite outgrowth.
  • Tissue specificity
    In the eye, associated with photoreceptor outer and inner segment regions, the nerve fiber layer, outer nuclear layer and inner and outer plexiform layers of the retina.
  • Involvement in disease
    Defects in EFEMP1 are a cause of Doyne honeycomb retinal dystrophy (DHRD) [MIM:126600]; also known as malattia leventinese (MLVT) (ML). DHRD is an autosomal dominant disease characterized by yellow-white deposits known as drusen that accumulate beneath the retinal pigment epithelium.
  • Sequence similarities
    Belongs to the fibulin family.
    Contains 6 EGF-like domains.
  • Cellular localization
    Secreted > extracellular space. Secreted > extracellular space > extracellular matrix. Localizes to the lamina propria underneath the olfactory epithelium.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114651 at approximately 79.97kDa stained with Coomassie Blue.

References

ab114651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up