Overview

  • Product name
    Recombinant Human Eg5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LLDQLKRKQPELLMMLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPS VDAGVDCSSIGGVPFFQHKKSHGKDKENRGINTLERSKVEETTEHLVTKS RLPLRAQINL
    • Molecular weight
      38 kDa including tags
    • Amino acids
      947 to 1056

Specifications

Our Abpromise guarantee covers the use of ab152491 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EG5
    • HKSP
    • KIF11
    • KIF11_HUMAN
    • Kinesin family member 11
    • Kinesin like protein 1
    • Kinesin-like protein 1
    • Kinesin-like protein KIF11
    • Kinesin-like spindle protein HKSP
    • Kinesin-related motor protein Eg5
    • KNSL1
    • MCLMR
    • Thyroid receptor-interacting protein 5
    • TR-interacting protein 5
    • TRIP-5
    • TRIP5
    see all
  • Function
    Motor protein required for establishing a bipolar spindle. Blocking of KIF11 prevents centrosome migration and arrest cells in mitosis with monoastral microtubule arrays.
  • Involvement in disease
    Defects in KIF11 are the cause of microcephaly with or without chorioretinopathy, lymphedema, or mental retardation (MCLMR) [MIM:152950]. An autosomal dominant disorder that involves an overlapping but variable spectrum of central nervous system and ocular developmental anomalies. Microcephaly ranges from mild to severe and is often associated with mild to moderate developmental delay and a characteristic facial phenotype with upslanting palpebral fissures, broad nose with rounded tip, long philtrum with thin upper lip, prominent chin, and prominent ears. Chorioretinopathy is the most common eye abnormality, but retinal folds, microphthalmia, and myopic and hypermetropic astigmatism have also been reported, and some individuals have no overt ocular phenotype. Congenital lymphedema, when present, is typically confined to the dorsa of the feet, and lymphoscintigraphy reveals the absence of radioactive isotope uptake from the webspaces between the toes.
  • Sequence similarities
    Belongs to the kinesin-like protein family. BimC subfamily.
    Contains 1 kinesin-motor domain.
  • Post-translational
    modifications
    Phosphorylated exclusively on serine during S phase, but on both serine and Thr-926 during mitosis, so controlling the association of KIF11 with the spindle apparatus (probably during early prophase). Phosphorylated upon DNA damage, probably by ATM or ATR.
    A subset of this protein primarily localized at the spindle pole is phosphorylated by NEK6 during mitosis; phosphorylation is required for mitotic function.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton > spindle pole.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152491 stained with Coomassie Blue.

References

ab152491 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152491.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up